missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ABCC12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ABCC12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ABCC12 Polyclonal specifically detects ABCC12 in Mouse samples. It is validated for Western Blot.Specifications
| ABCC12 | |
| Polyclonal | |
| Rabbit | |
| Q80WJ6 | |
| 94160 | |
| Synthetic peptides corresponding to Abcc12 (ATP-binding cassette, sub-family C (CFTR/MRP), member 12) The peptide sequence was selected from the middle region of Abcc12. Peptide sequence NILFGEKYNHQRYQHTVHVCGLQKDLNSLPYGDLTEIGERGVNLSGGQRQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| ATP-binding cassette transporter sub-family C member 12, ATP-binding cassette, sub-family C (CFTR/MRP), member 12, MGC27071, MRP9ATP-binding cassette sub-family C member 12, multidrug resistance-associated protein 9 | |
| Abcc12 | |
| IgG | |
| 153 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title