BRDT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80294

Product Code. 18268105

Description

BRDT Polyclonal specifically detects BRDT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BRDT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: bromodomain testis-specific protein, bromodomain, testis-specific, Cancer/testis antigen 9, CT9BRD6, RING3-like protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: NP_001717
• Gene Symbols: BRDT
• Immunogen: Synthetic peptide directed towards the N terminal of human BRDT. Peptide sequence MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSW.
• Quantity: 100 μL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 676
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG