missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BRDT Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | BRDT |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
BRDT Polyclonal specifically detects BRDT in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| BRDT | |
| Unconjugated | |
| RUO | |
| NP_001717 | |
| 676 | |
| Synthetic peptide directed towards the N terminal of human BRDT. Peptide sequence MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSW. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| bromodomain testis-specific protein, bromodomain, testis-specific, Cancer/testis antigen 9, CT9BRD6, RING3-like protein | |
| BRDT | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title