missing translation for 'onlineSavingsMsg'
Learn More
Learn More
5-HT1B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£281.00 - £417.00
Specifications
| Antigen | 5-HT1B |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18216705
|
Novus Biologicals
NBP2-55461 |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18606647
|
Novus Biologicals
NBP2-55461-25ul |
25 μL |
£281.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
5-HT1B Polyclonal specifically detects 5-HT1B in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| 5-HT1B | |
| Polyclonal | |
| Rabbit | |
| GPCR | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 3351 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| 5-HT1B5-HT-1B, 5-HT1DB, 5-hydroxytryptamine (serotonin) receptor 1B, HTR1D2,5-hydroxytryptamine receptor 1B, HTR1DB, S125-HT-1D-beta, Serotonin 1D beta receptor, Serotonin receptor 1B | |
| HTR1B | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title