5-HT1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55461-25ul

Produktkod. 18606647

Beskrivning

5-HT1B Polyclonal specifically detects 5-HT1B in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifikationer

• Antigen: 5-HT1B
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: 5-HT1B5-HT-1B, 5-HT1DB, 5-hydroxytryptamine (serotonin) receptor 1B, HTR1D2,5-hydroxytryptamine receptor 1B, HTR1DB, S125-HT-1D-beta, Serotonin 1D beta receptor, Serotonin receptor 1B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: HTR1B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDS
• Quantity: 25 μL
• Research Discipline: GPCR
• Gene ID (Entrez): 3351
• Target Species: Human
• Isotype: IgG

For Research Use Only