missing translation for 'onlineSavingsMsg'
Learn More
Learn More
17 beta-HSD14/HSD17B14 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | 17 beta-HSD14/HSD17B14 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
17 beta-HSD14/HSD17B14 Polyclonal specifically detects 17 beta-HSD14/HSD17B14 in Human samples. It is validated for Western Blot.Specifications
| 17 beta-HSD14/HSD17B14 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| dehydrogenase/reductase (SDR family) member 10, Dehydrogenase/reductase SDR family member 10, DHRS1017-beta-hydroxysteroid dehydrogenase 14, EC 1.1.1.-, hydroxysteroid (17-beta) dehydrogenase 14,17-beta-hydroxysteroid dehydrogenase DHRS10, retinal short-chain dehydrogenase/reductase 3, Retinal short-chain dehydrogenase/reductase retSDR3, retSDR3, RETSDR3,17-beta-HSD 14, SDR3, SDR47C1, short chain dehydrogenase/reductase family 47C, member 1 | |
| HSD17B14 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9BPX1 | |
| 51171 | |
| Synthetic peptides corresponding to HSD17B14(hydroxysteroid (17-beta) dehydrogenase 14) The peptide sequence was selected from the N terminal of HSD17B14. Peptide sequence RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title