17 beta-HSD14/HSD17B14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56863

Product Code. 18254934

Description

17 beta-HSD14/HSD17B14 Polyclonal specifically detects 17 beta-HSD14/HSD17B14 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: 17 beta-HSD14/HSD17B14
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dehydrogenase/reductase (SDR family) member 10, Dehydrogenase/reductase SDR family member 10, DHRS1017-beta-hydroxysteroid dehydrogenase 14, EC 1.1.1.-, hydroxysteroid (17-beta) dehydrogenase 14,17-beta-hydroxysteroid dehydrogenase DHRS10, retinal short-chain dehydrogenase/reductase 3, Retinal short-chain dehydrogenase/reductase retSDR3, retSDR3, RETSDR3,17-beta-HSD 14, SDR3, SDR47C1, short chain dehydrogenase/reductase family 47C, member 1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Mouse: 92%; Rabbit: 85%; Pig: 84%; Rat: 84%.
• Target Species: Human, Mouse, Rat, Pig, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BPX1
• Gene Symbols: HSD17B14
• Immunogen: Synthetic peptides corresponding to HSD17B14(hydroxysteroid (17-beta) dehydrogenase 14) The peptide sequence was selected from the N terminal of HSD17B14. Peptide sequence RVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLD.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 51171
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.