missing translation for 'onlineSavingsMsg'
Learn More
Learn More
17 beta-HSD1/HSD17B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
£381.00
Specifications
| Antigen | 17 beta-HSD1/HSD17B1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
17 beta-HSD1/HSD17B1 Polyclonal specifically detects 17 beta-HSD1/HSD17B1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| 17 beta-HSD1/HSD17B1 | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Cancer | |
| 17-beta-HSD 1, 17-beta-hydroxysteroid dehydrogenase type 1, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha-HSD, E17KSR, E2DH, EC 1.1.1.62, EDH17B1, EDH17B2EDHB17, estradiol 17-beta-dehydrogenase 1, estradiol 17-beta-dehydrogenase-1, HSD17, hydroxysteroid (17-beta) dehydrogenase 1, hydroxysteroid (17-beta) dehydrogenase 1 isoform, MGC138140, Placental 17-beta-hydroxysteroid dehydrogenase, SDR28C1, short chain dehydrogenase/reductase family 28CE, member 1 | |
| HSD17B1 | |
| IgG | |
| 35 kDa |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| P14061 | |
| 3292 | |
| Synthetic peptides corresponding to HSD17B1(hydroxysteroid (17-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of HSD17B1 (NP_000404). Peptide sequence MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title