17 beta-HSD1/HSD17B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Brand:  Novus Biologicals NBP1-56295

Product Code. 18271525

Description

17 beta-HSD1/HSD17B1 Polyclonal specifically detects 17 beta-HSD1/HSD17B1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: 17 beta-HSD1/HSD17B1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 17-beta-HSD 1, 17-beta-hydroxysteroid dehydrogenase type 1, 20 alpha-hydroxysteroid dehydrogenase, 20-alpha-HSD, E17KSR, E2DH, EC 1.1.1.62, EDH17B1, EDH17B2EDHB17, estradiol 17-beta-dehydrogenase 1, estradiol 17-beta-dehydrogenase-1, HSD17, hydroxysteroid (17-beta) dehydrogenase 1, hydroxysteroid (17-beta) dehydrogenase 1 isoform, MGC138140, Placental 17-beta-hydroxysteroid dehydrogenase, SDR28C1, short chain dehydrogenase/reductase family 28CE, member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Research Discipline: Breast Cancer, Cancer
• Gene ID (Entrez): 3292
• Reconstitution: Reconstitute in 50μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 4-8 ug/ml, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: P14061
• Gene Symbols: HSD17B1
• Immunogen: Synthetic peptides corresponding to HSD17B1(hydroxysteroid (17-beta) dehydrogenase 1) The peptide sequence was selected from the N terminal of HSD17B1 (NP_000404). Peptide sequence MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG