missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A15 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93531-0.02ml
This item is not returnable.
View return policy
Beskrivning
SLC6A15 Polyclonal antibody specifically detects SLC6A15 in Mouse samples. It is validated for Western Blot
Specifikationer
| SLC6A15 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human SLC6A15 (NP_877499.1). LVVFAVLGFKANVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPALHLNSCKIEEELNKAVQGTGLAFIAFTEAM | |
| 0.02 mL | |
| Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction | |
| 55117 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse | |
| Purified |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering