missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC6A15 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £366.00
Specifications
| Antigen | SLC6A15 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18693160
|
Novus Biologicals
NBP2-93531-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18666570
|
Novus Biologicals
NBP2-93531-0.1ml |
0.1 mL |
£366.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC6A15 Polyclonal antibody specifically detects SLC6A15 in Mouse samples. It is validated for Western BlotSpecifications
| SLC6A15 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Amino Acids Drugs and other small molecules, Endocrinology, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 55117 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 350-450 of human SLC6A15 (NP_877499.1). LVVFAVLGFKANVINEKCITQNSETIMKFLKMGNISQDIIPHHINLSTVTAEDYHLVYDIIQKVKEEEFPALHLNSCKIEEELNKAVQGTGLAFIAFTEAM | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title