missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Connexin 36/GJD2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92416-0.02ml
This item is not returnable.
View return policy
Description
Connexin 36/GJD2 Polyclonal antibody specifically detects Connexin 36/GJD2 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| Connexin 36/GJD2 | |
| Polyclonal | |
| Western Blot 1:200-1:2000 | |
| Connexin-36, Cx36, CX36connexin 36, Gap junction alpha-9 protein, gap junction delta-2 protein, gap junction protein, alpha 9, 36kDa, gap junction protein, delta 2, 36kDa, GJA9connexin-36, MGC138315, MGC138319 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 99-197 of human GJD2 (NP_065711.1). HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR | |
| 0.02 mL | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 57369 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction