missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Connexin 36/GJD2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £359.00
Specifications
| Antigen | Connexin 36/GJD2 |
|---|---|
| Dilution | Western Blot 1:200-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18698200
|
Novus Biologicals
NBP2-92416-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18676831
|
Novus Biologicals
NBP2-92416-0.1ml |
0.1 mL |
£359.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Connexin 36/GJD2 Polyclonal antibody specifically detects Connexin 36/GJD2 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| Connexin 36/GJD2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 57369 | |
| IgG | |
| Affinity purified |
| Western Blot 1:200-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Connexin-36, Cx36, CX36connexin 36, Gap junction alpha-9 protein, gap junction delta-2 protein, gap junction protein, alpha 9, 36kDa, gap junction protein, delta 2, 36kDa, GJA9connexin-36, MGC138315, MGC138319 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 99-197 of human GJD2 (NP_065711.1). HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title