Filtered Search Results
Search results for "A/7770"
Anti-Bumping Granules, Extra Pure, Fused Alumina, SLR, Fisher Chemical™
Added to liquids to make them boil more calmly.
| Material | Fused Alumina |
|---|
| CAS | 7770-78-7 |
|---|---|
| Molecular Formula | C21H24O6 |
Invitrogen™ ZNF227 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ ZNF227 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Tocris Bioscience™ Arctigenin
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
CAS: 7770-78-7 Molecular Formula: C21H24O6
| CAS | 7770-78-7 |
|---|---|
| Molecular Formula | C21H24O6 |
Potassium nitrite, 97%, for analysis
CAS: 7758-09-0 Molecular Formula: KNO2 Molecular Weight (g/mol): 85.10 MDL Number: MFCD00011408 InChI Key: BXNHTSHTPBPRFX-UHFFFAOYSA-M Synonym: potassium nitrite,nitrous acid, potassium salt,caswell no. 698,ccris 3959,potassium nitrite 1:1,epa pesticide chemical code 076203,nitrous acid, potassium salt 1:1,kaliumnitrit,acmc-1bi01,dsstox_cid_22320 PubChem CID: 516910 SMILES: [K+].[O-]N=O
| PubChem CID | 516910 |
|---|---|
| CAS | 7758-09-0 |
| Molecular Weight (g/mol) | 85.10 |
| MDL Number | MFCD00011408 |
| SMILES | [K+].[O-]N=O |
| Synonym | potassium nitrite,nitrous acid, potassium salt,caswell no. 698,ccris 3959,potassium nitrite 1:1,epa pesticide chemical code 076203,nitrous acid, potassium salt 1:1,kaliumnitrit,acmc-1bi01,dsstox_cid_22320 |
| InChI Key | BXNHTSHTPBPRFX-UHFFFAOYSA-M |
| Molecular Formula | KNO2 |
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry |
| Form | Purified |
| Isotype | IgG |
| Antigen | ZNF227 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Gene Alias | KIAA1084, zinc finger protein 507 |
| Gene ID (Entrez) | 7770 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-230 of human ZNF227 (NP_872296.1). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Potassium nitrite, 96+%, ACS reagent
CAS: 7758-09-0 Molecular Formula: KNO2 Molecular Weight (g/mol): 85.10 MDL Number: MFCD00011408 InChI Key: BXNHTSHTPBPRFX-UHFFFAOYSA-M Synonym: potassium nitrite,nitrous acid, potassium salt,caswell no. 698,ccris 3959,potassium nitrite 1:1,epa pesticide chemical code 076203,nitrous acid, potassium salt 1:1,kaliumnitrit,acmc-1bi01,dsstox_cid_22320 PubChem CID: 516910 SMILES: [K+].[O-]N=O
| PubChem CID | 516910 |
|---|---|
| CAS | 7758-09-0 |
| Molecular Weight (g/mol) | 85.10 |
| MDL Number | MFCD00011408 |
| SMILES | [K+].[O-]N=O |
| Synonym | potassium nitrite,nitrous acid, potassium salt,caswell no. 698,ccris 3959,potassium nitrite 1:1,epa pesticide chemical code 076203,nitrous acid, potassium salt 1:1,kaliumnitrit,acmc-1bi01,dsstox_cid_22320 |
| InChI Key | BXNHTSHTPBPRFX-UHFFFAOYSA-M |
| Molecular Formula | KNO2 |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | AAO45835 |
| Antigen | ZNF227 |
| Gene Symbols | ZNF227 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Molecular Weight of Antigen | 30 kDa |
| Gene Alias | KIAA1084, zinc finger protein 507 |
| Gene ID (Entrez) | 7770 |
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF227. Peptide sequence ESGDCFNKSSFHSYQSNHTGEKSYRCDSCGKGFSSSTGLIIHYRTHTGEK. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Host Species | Rabbit |
|---|---|
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | NP_872296 |
| Antigen | ZNF227 |
| Gene Symbols | ZNF227 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 92 kDa |
| Gene Alias | KIAA1084, zinc finger protein 507 |
| Gene ID (Entrez) | 7770 |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF227. Peptide sequence QIWKQVASELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGDSSIYIENQ. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
ZNF227, Rabbit, Polyclonal Antibody, Abnova™
Rabbit polyclonal antibody raised against recombinant ZNF227.
80UL Anti-Zinc finger protein 227/ZNF227 Polyclonal Antibody Clone RB33355 Ig ZNF227 7770
16687068 80UL Anti-Zinc finger protein 227/ZNF227 Polyclonal Antibody Clone RB33355 Ig ZNF227 7770
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
400UL Anti-Zinc finger protein 227/ZNF227 Polyclonal Antibody Clone RB33355 Ig ZNF227 7770
16677068 400UL Anti-Zinc finger protein 227/ZNF227 Polyclonal Antibody Clone RB33355 Ig ZNF227 7770
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More