accessibility menu, dialog, popup

UserName

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (6,388)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

centrifuges

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (138)

brands

  • (3)
  • (1)
  • (8)
  • (6,374)
  • (1)
  • (1)

special programs

  • (3)
  • (6)

Classification

  • (791)
  • (5,594)
  • (2)

Conjugate

  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
  • (1)
Show all

Host Species

  • (3)
  • (17)
  • (3)
  • (2)
  • (755)
  • (5,602)
  • (5)

Quantity

  • (9)
  • (9)
  • (5)
  • (1)
  • (5)
  • (109)
  • (28)
Show all

Applications

  • (3)
  • (9)
  • (10)
  • (2)
  • (32)
  • (56)
  • (1)
Show all

Target Species

  • (1)
  • (1)
  • (5)
  • (1)
  • (1)
  • (4,274)
  • (4,217)
Show all

Regulatory Status

  • (6,382)

Isotype

  • (5,560)
  • (31)
  • (497)
  • (4)
  • (2)
  • (2)
  • (128)
Show all

Form

  • (50)
  • (9)
  • (14)
  • (1,441)
1 – 15 of 6,374 results
1

Invitrogen™ La Crosse Virus Monoclonal Antibody (8C2.2)
GREENER_CHOICE

Mouse Monoclonal Antibody

2

Invitrogen™ La Crosse Virus Monoclonal Antibody (10G5.4)
GREENER_CHOICE

Mouse Monoclonal Antibody

3

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

4

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

5

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

6

Invitrogen™ TMBIM1 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

10

ZNF491 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_689569
Antigen ZNF491
Gene Symbols ZNF491
Regulatory Status RUO
Molecular Weight of Antigen 51 kDa
Gene Alias FLJ34791, MGC126639, zinc finger protein 491
Gene ID (Entrez) 126069
Immunogen Synthetic peptide directed towards the N terminal of human ZNF491. Peptide Sequence: SFNRNIRTDTGHQPHKCQKFLEKPYKHKQRRKALSHSHCFRTHERPHTRE
Classification Polyclonal
Primary or Secondary Primary
11

ZNF680 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_848653
Antigen ZNF680
Gene Symbols ZNF680
Regulatory Status RUO
Molecular Weight of Antigen 62 kDa
Gene Alias FLJ90430, zinc finger protein 680
Gene ID (Entrez) 340252
Immunogen Synthetic peptide directed towards the N terminal of human ZNF680. Peptide sequence: RGYGKCGHENLQLRISCKSVDESKVFKEGYNELNQCLRTTQSKIFQCDKY
Classification Polyclonal
Primary or Secondary Primary
12

OTUD6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_997203
Antigen OTUD6A
Gene Symbols OTUD6A
Regulatory Status RUO
Molecular Weight of Antigen 32 kDa
Gene Alias DUBA2, DUBA-2, OTU domain containing 6A
Gene ID (Entrez) 139562
Immunogen Synthetic peptide directed towards the N terminal of human OTUD6A. Peptide sequence MEAEMAQKHRQELEKFQDDSSIESVVEDLAKMNLENRPPRSSKAHRKRER.
Classification Polyclonal
Primary or Secondary Primary
13

ZNF670 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Gene Accession No. NP_149990
Antigen ZNF670
Gene Symbols ZNF670
Regulatory Status RUO
Purification Method Protein A purified
Molecular Weight of Antigen 45 kDa
Gene Alias FLJ12606, MGC12466, zinc finger protein 670
Gene ID (Entrez) 93474
Immunogen Synthetic peptide directed towards the N terminal of human ZNF670. Peptide sequence EDQNIQDDFKNPGRNLSSHVVERLFEIKEGSQYGETFSQDSNLNLNKKVS.
Classification Polyclonal
Primary or Secondary Primary
14

ZNF570 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_653295
Antigen ZNF570
Gene Symbols ZNF570
Regulatory Status RUO
Molecular Weight of Antigen 62 kDa
Gene Alias zinc finger protein 570
Gene ID (Entrez) 148268
Immunogen Synthetic peptide directed towards the N terminal of human ZNF570. Peptide sequence QGKAPWMVKRELTKGLCSGWEPICETEELTPKQDFYEEHQSQKIIETLTS.
Classification Polyclonal
Primary or Secondary Primary
15

ZNF417 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_689688
Antigen ZNF417
Gene Symbols ZNF417
Regulatory Status RUO
Molecular Weight of Antigen 66 kDa
Gene Alias MGC34079, zinc finger protein 417
Gene ID (Entrez) 147687
Immunogen Synthetic peptide directed towards the N terminal of human ZNF417. Peptide Sequence: HQETHHKQKLNRSGACGKNLDDTAYLHQHQKQHIGEKFYRKSVREASFVK
Classification Polyclonal
Primary or Secondary Primary