accessibility menu, dialog, popup

UserName

Primary Antibodies

Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
All Primary Antibodies (88,186)
Primary Antibody Matched Pairs (14)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

cell biology

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

special offers

  • (1,174)

brands

  • (36)
  • (153)
  • (1,838)
  • (570)
  • (94)
  • (1)
  • (81,983)
  • (3,513)
  • (12)

special programs

  • (36)
  • (11)

Classification

  • (61,324)
  • (10)
  • (26,747)

Conjugate

  • (2,201)
  • (372)
  • (3)
  • (22)
  • (1)
  • (2,007)
  • (2,201)
Show all

Quantity

  • (1)
  • (714)
  • (172)
  • (257)
  • (220)
  • (38)
  • (209)
Show all

Host Species

  • (102)
  • (131)
  • (1,486)
  • (60)
  • (1,890)
  • (44,449)
  • (34,917)
Show all

Applications

  • (23)
  • (12)
  • (28)
  • (116)
  • (16)
  • (193)
  • (84)
Show all

Target Species

  • (1)
  • (15)
  • (43)
  • (76)
  • (5)
  • (169)
  • (16)
Show all

Isotype

  • (2)
  • (1)
  • (4)
  • (4)
  • (2)
  • (11)
  • (3)
Show all

Regulatory Status

  • (48)
  • (84,148)

Form

  • (47)
  • (82)
  • (71)
  • (458)
  • (59)
  • (15)
  • (14)
Show all
1 – 15 of 84,144 results
2

Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Gene Accession No. P23946
Research Discipline Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers
Antigen Chymase/CMA1/Mast Cell Chymase
Gene Symbols CMA1
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Gene Alias Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Gene ID (Entrez) 1215
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
3

Chymase/CMA1/Mast Cell Chymase Antibody (CC1), Novus Biologicals™

Mouse Monoclonal Antibody has been used in 2 publications

Content And Storage Store at 4C. Do not freeze.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Form Purified
Isotype IgG1
Gene Accession No. P23946
Research Discipline Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers
Antigen Chymase/CMA1/Mast Cell Chymase
Gene Symbols CMA1
Regulatory Status RUO
Purification Method Protein A or G purified
Gene Alias Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
Gene ID (Entrez) 1215
Immunogen BALB/C mice were injected with a purified human skin chymase.
Classification Monoclonal
Primary or Secondary Primary
Test Specificity This reacts with mast cells distributed in skin, synovium, lung and heart.
Clone CC1
4

Mast Cell Marker Antibody (MCG35) - BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Mouse
Conjugate Unconjugated
Applications Immunohistochemistry
Form Purified
Isotype IgG1 κ
Research Discipline Cardiovascular Biology
Concentration 1 mg/mL
Antigen Mast Cell Marker
Regulatory Status RUO
Purification Method Protein A purified
Dilution Immunohistochemistry 1:10 - 1:500
Formulation PBS
Immunogen Spleen cells and bone marrow cells (erythrocyte depleted) from a patient with systemic mastocytosis. The bone marrow preparation consisted of 50% typical mast cells.
Classification Monoclonal
Primary or Secondary Primary
Clone MCG35
5

L1 Cell Adhesion Molecule Ab-1 Mouse Monoclonal Antibody, Epredia™

Recommended for Immunohistochemistry (Formalin/paraffin), Western Blotting and Immunoprecipitation (Native and denatured), Epredia™ L1 Cell Adhesion Molecule Ab-1, Mouse Monoclonal Antibody provides accurate, reproducible results.

Antigen L1 Cell Adhesion Molecule Ab-1
Regulatory Status RUO
Target Species Human
Host Species Mouse
Applications Immunohistochemistry (Paraffin),Immunoprecipitation,Western Blot
Immunogen Homogenous suspension of 16 week human fetal brain
Classification Monoclonal
Isotype IgG2a κ
Primary or Secondary Primary
Research Discipline Cancer and Tumor Biology
Clone UJ127
6
Promotions Available

Panendothelial Cell Antigen Antibody (MECA-32), Alexa Fluor™ 488, Novus Biologicals™

Rat Monoclonal Antibody

Content And Storage Store at 4°C in the dark.
Target Species Human,Mouse
Host Species Rat
Conjugate Alexa Fluor 488
Applications Western Blot,Flow Cytometry,Immunohistochemistry,Immunocytochemistry/Immunofluorescence,Immunoprecipitation
Form Purified
Isotype IgG2a κ
Research Discipline Cancer, Cell Biology, Cellular Markers, Endothelial Cell Markers, Extracellular Matrix, Hypoxia, Immunology, Mesenchymal Stem Cell Markers, Stem Cell Markers
Antigen Panendothelial Cell Antigen
Regulatory Status RUO
Purification Method Protein G purified
Gene Alias FELS, Fenestrated endothelial-linked structure protein, gp68, MECA32, MECA-32, Panendothelial Cell Antigen, plasmalemma vesicle associated protein, Plasmalemma Vesicle Protein 1, PV-1 protein
Gene ID (Entrez) 84094
Formulation 50mM Sodium Borate
Immunogen Mouse lymph node stromal cells.
Classification Monoclonal
Primary or Secondary Primary
Clone MECA-32
7

Epredia™ Lab Vision™ CD3 (Early T-Cell Marker) Rabbit Monoclonal Antibody,

Stain normal and neoplastic T cells in formalin-fixed, paraffin-embedded tissues with Epredia™ CD3 (Early T-Cell Marker), Rabbit Monoclonal Antibody.

Antigen CD3
Regulatory Status IVD
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin)
Immunogen A synthetic 13-mer peptide corresponding to aa 156-168 of the epsilon-chain of human CD3 protein
Classification Monoclonal
Primary or Secondary Primary
Research Discipline Cancer and Tumor Biology
Clone SP7
8

CD31/PECAM-1 (Endothelial Cell Marker) Rabbit Polyclonal Antibody, Epredia™

Ensure accurate, reproducible results in immunohistochemistry procedures with Epredia™ CD31/PECAM-1 (Endothelial Cell Marker), Rabbit Polyclonal Antibody.

Antigen CD31 (Endothelial Cell Marker)
Regulatory Status RUO
Purification Method Tonsil
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin)
Immunogen Synthetic peptide corresponding to C-terminus of mouse CD31 protein
Classification Polyclonal
Primary or Secondary Primary
Research Discipline Cancer and Tumor Biology
9

Renal Cell Carcinoma Marker (gp200) Ab-1 Mouse Monoclonal Antibody, Epredia™

Provide accurate, reproducible results with the Epredia™ Renal Cell Carcinoma Marker (gp200) Ab-1, Mouse Monoclonal Antibody.

Antigen Renal Cell Carcinoma Marker (gp200) Ab-1
Regulatory Status IVD
Host Species Mouse
Applications Immunohistochemistry (Paraffin),Western Blot
Immunogen Microsomal fraction of human renal cortical tissue homogenate
Classification Monoclonal
Primary or Secondary Primary
Research Discipline Cancer and Tumor Biology
Clone PN-15
10

Epredia™ Lab Vision™ Desmin (Muscle Cell Marker) Ab-1, Mouse Monoclonal Antibody

Specifically detect desmin in human, baboon, monkey, cow, cat, dog, hamster, rat and chicken samples.

Antigen Desmin (Muscle Cell Marker) Ab-1
Regulatory Status IVD
Host Species Mouse
Conjugate Unconjugated
Applications Immunofluorescence,Immunohistochemistry (Paraffin)
Immunogen Desmin from human muscle
Classification Monoclonal
Primary or Secondary Primary
Research Discipline Muscle Biology
Clone D33
11

Epredia™ Lab Vision™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody

Obtain accurate, reproducible results in immunohistochemistry experiments with Epredia™ CD79a/mb-1 (B-Cell Marker), Rabbit Monoclonal Antibody.

Antigen CD79a/mb-1 (B-Cell Marker)
Regulatory Status IVD
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry (Paraffin)
Immunogen Synthetic peptide derived from N-terminal region of human CD79a protein
Classification Monoclonal
Primary or Secondary Primary
Research Discipline Cancer and Tumor Biology
Clone SP18
13

Thy-1 cell surface antigen, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human THY1 protein.