Primary Antibodies
Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
8
of
8
results
Invitrogen™ ZNF227 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ ZNF227 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunohistochemistry |
| Form | Purified |
| Isotype | IgG |
| Antigen | ZNF227 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Gene Alias | KIAA1084, zinc finger protein 507 |
| Gene ID (Entrez) | 7770 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-230 of human ZNF227 (NP_872296.1). |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Target Species | Human |
|---|---|
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Gene Accession No. | AAO45835 |
| Antigen | ZNF227 |
| Gene Symbols | ZNF227 |
| Regulatory Status | RUO |
| Purification Method | Protein A purified |
| Molecular Weight of Antigen | 30 kDa |
| Gene Alias | KIAA1084, zinc finger protein 507 |
| Gene ID (Entrez) | 7770 |
| Immunogen | Synthetic peptide directed towards the middle region of human ZNF227. Peptide sequence ESGDCFNKSSFHSYQSNHTGEKSYRCDSCGKGFSSSTGLIIHYRTHTGEK. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
ZNF227, Rabbit, Polyclonal Antibody, Abnova™
Rabbit polyclonal antibody raised against recombinant ZNF227.
| Host Species | Rabbit |
|---|---|
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Isotype | IgG |
| Gene Accession No. | NP_872296 |
| Antigen | ZNF227 |
| Gene Symbols | ZNF227 |
| Regulatory Status | RUO |
| Molecular Weight of Antigen | 92 kDa |
| Gene Alias | KIAA1084, zinc finger protein 507 |
| Gene ID (Entrez) | 7770 |
| Immunogen | Synthetic peptide directed towards the N terminal of human ZNF227. Peptide sequence QIWKQVASELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGDSSIYIENQ. |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Isotype | IgG |
| Antigen | ZNF227 |
| Gene Symbols | ZNF227 |
| Regulatory Status | RUO |
| Purification Method | Affinity Purified |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Gene Alias | KIAA1084, zinc finger protein 507 |
| Gene ID (Entrez) | 7770 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:FWRTQHSCGNTYLSESQIQSRGKQIDVKNNLQIHEDFMKKSPFHEHIKTDTEPKPCKGNEYGKIISDGSNQKLPL |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
| Test Specificity | Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |