accessibility menu, dialog, popup

UserName

Antibodies

Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Primary Antibodies (10)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Selected Filters

Clear all

Keyword Search

A/7770

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (1)
  • (2)
  • (6)
  • (1)

special programs

  • (2)

Applications

  • (4)
  • (3)
  • (4)
  • (1)
  • (4)
  • (7)

Classification

  • (10)

Conjugate

  • (10)

Host Species

  • (10)

Isotype

  • (10)

Quantity

  • (1)
  • (7)
  • (1)
  • (1)

Regulatory Status

  • (10)

Target Species

  • (1)
  • (10)
  • (1)

Form

  • (4)
  • (3)
1 – 8 of 8 results
1

Invitrogen™ ZNF227 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

2

Invitrogen™ ZNF227 Polyclonal Antibody
GREENER_CHOICE

Rabbit Polyclonal Antibody

4

ZNF227 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot,Immunohistochemistry
Form Purified
Isotype IgG
Antigen ZNF227
Regulatory Status RUO
Purification Method Affinity purified
Gene Alias KIAA1084, zinc finger protein 507
Gene ID (Entrez) 7770
Formulation PBS with 50% glycerol, pH7.3.
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-230 of human ZNF227 (NP_872296.1).
Classification Polyclonal
Primary or Secondary Primary
5

ZNF227, Rabbit, Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against recombinant ZNF227.

6

ZNF227 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Form Purified
Isotype IgG
Gene Accession No. AAO45835
Antigen ZNF227
Gene Symbols ZNF227
Regulatory Status RUO
Purification Method Protein A purified
Molecular Weight of Antigen 30 kDa
Gene Alias KIAA1084, zinc finger protein 507
Gene ID (Entrez) 7770
Immunogen Synthetic peptide directed towards the middle region of human ZNF227. Peptide sequence ESGDCFNKSSFHSYQSNHTGEKSYRCDSCGKGFSSSTGLIIHYRTHTGEK.
Classification Polyclonal
Primary or Secondary Primary
7

ZNF227 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Host Species Rabbit
Conjugate Unconjugated
Applications Western Blot
Isotype IgG
Gene Accession No. NP_872296
Antigen ZNF227
Gene Symbols ZNF227
Regulatory Status RUO
Molecular Weight of Antigen 92 kDa
Gene Alias KIAA1084, zinc finger protein 507
Gene ID (Entrez) 7770
Immunogen Synthetic peptide directed towards the N terminal of human ZNF227. Peptide sequence QIWKQVASELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGDSSIYIENQ.
Classification Polyclonal
Primary or Secondary Primary
8

ZNF227 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Target Species Human
Host Species Rabbit
Conjugate Unconjugated
Applications Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin)
Isotype IgG
Antigen ZNF227
Gene Symbols ZNF227
Regulatory Status RUO
Purification Method Affinity Purified
Dilution Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Gene Alias KIAA1084, zinc finger protein 507
Gene ID (Entrez) 7770
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FWRTQHSCGNTYLSESQIQSRGKQIDVKNNLQIHEDFMKKSPFHEHIKTDTEPKPCKGNEYGKIISDGSNQKLPL
Classification Polyclonal
Primary or Secondary Primary
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.