missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Zyxin Antibody (CL2502), Novus Biologicals™

Zyxin Antibody (CL2502), Novus Biologicals™

Product Code. 18162109 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18162109 0.1 mL 0.1mL
18695975 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18162109 Supplier Novus Biologicals Supplier No. NBP236768

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Zyxin Monoclonal specifically detects Zyxin in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Zyxin
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL2502
Conjugate Unconjugated
Dilution Immunohistochemistry 1:5000 - 1:10000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:5000 - 1:10000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q15942
Gene Alias CTCL tumor antigen se14-3, CTCL-associated antigen se14-3, cutaneous T-cell lymphoma associated antigen se14-3, Cutaneous T-cell lymphoma-associated antigen se14-3, KIAA1125, MGC31836, predicted protein of HQ2893, PRKCBP1, PRO2893, protein kinase C-binding protein 1, Rack7, RACK7protein kinase C binding protein 1, zinc finger MYND domain containing protein 8, Zinc finger MYND domain-containing protein 8, zinc finger, MYND-type containing 8
Gene Symbols ZYX
Host Species Mouse
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PAPKFSPVTPKFTPVASKFSPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGPLTLKEVEELEQLTQQLMQDMEHPQRQNVAVNE
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7791
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reconstitution Protein A purified
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.