missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZXDC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZXDC |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZXDC Polyclonal specifically detects ZXDC in Human samples. It is validated for Western Blot.Specifications
| ZXDC | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| dJ337O18.5, SWIM domain containing 1, zinc finger, SWIM-type containing 1 | |
| ZXDC | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001035743 | |
| 79364 | |
| Synthetic peptide directed towards the middle region of human ZXDCThe immunogen for this antibody is ZXDC. Peptide sequence NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title