missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ZSCAN5 Polyclonal specifically detects ZSCAN5 in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | ZSCAN5 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | MGC4161, zinc finger and SCAN domain containing 5, zinc finger and SCAN domain containing 5A, zinc finger and SCAN domain-containing protein 5A, Zinc finger protein 495ZSCAN5, ZNF495 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ZSCAN5 (NP_077279). Peptide sequence KPDASSISQEEPQGEATPVGNRESPGQAGMNSIHSPGPASPVSHPDGQEA |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?