missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18420270

ZSCAN21/ZFP38 Antibody (4F10), Novus Biologicals™

Product Code. 18420270 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18420270 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18420270 Supplier Novus Biologicals Supplier No. H00007589M16

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ZSCAN21/ZFP38 Monoclonal antibody specifically detects ZSCAN21/ZFP38 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ZSCAN21/ZFP38
Applications Western Blot, ELISA
Classification Monoclonal
Clone 4F10
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_666019
Gene Alias DKFZp434L134, KOX25, NY-REN-21, Renal carcinoma antigen NY-REN-21, Zfp-38, ZFP38, zinc finger and SCAN domain containing 21, zinc finger and SCAN domain-containing protein 21, zinc finger protein 38, zinc finger protein 38 (KOX 25), Zinc finger protein 38 homolog, zinc finger protein NY-REN-21 antigen, Zipro1, ZNF38DKFZp686H10254
Host Species Mouse
Immunogen ZSCAN21 (NP_666019, 136 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TPPNEQKPVWEKISSSGTAKESPSSMQPQPLETSHKYESWGPLYIQESGEEQEFAQDPRKVRDCRLSTQHEESADEQKGSEAEGLKGDI
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7589
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.