missing translation for 'onlineSavingsMsg'
Learn More

ZRSR2 Antibody, Novus Biologicals™

Product Code. 18367638 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
50 μg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18367638 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18367638 Supplier Novus Biologicals Supplier No. H00008233B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Polyclonal Antibody

ZRSR2 Polyclonal antibody specifically detects ZRSR2 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ZRSR2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_005080
Gene Alias CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2, Renal carcinoma antigen NY-REN-20, U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-relatedprotein 2, U2 small nuclear ribonucleoprotein auxiliary factor, small subunit 2, U2(RNU2) small nuclear RNA auxiliary factor 1-like 2MGC142014, U2AF1L2, U2AF1RS2MGC142040, U2AF1-RS2U2AF35-related protein, URPU2 small nuclear RNA auxiliary factor 1-like 2, zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2
Host Species Mouse
Immunogen U2AF1L2 (NP_005080, 1 a.a. - 482 a.a.) full-length human protein. MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK
Purification Method Immunogen affinity purified
Quantity 50 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8233
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.