missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
ZRSR2 Monoclonal antibody specifically detects ZRSR2 in Human samples. It is validated for ELISA, ELISA
Specifications
Specifications
| Antigen | ZRSR2 |
| Applications | ELISA, Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 2H5 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_005080 |
| Gene Alias | CCCH type zinc finger, RNA-binding motif and serine/arginine rich protein 2, Renal carcinoma antigen NY-REN-20, U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-relatedprotein 2, U2 small nuclear ribonucleoprotein auxiliary factor, small subunit 2, U2(RNU2) small nuclear RNA auxiliary factor 1-like 2MGC142014, U2AF1L2, U2AF1RS2MGC142040, U2AF1-RS2U2AF35-related protein, URPU2 small nuclear RNA auxiliary factor 1-like 2, zinc finger (CCCH type), RNA-binding motif and serine/arginine rich 2 |
| Host Species | Mouse |
| Immunogen | U2AF1L2 (NP_005080.1, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?