Learn More
Invitrogen™ ZP3 Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA595637
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human MCF-7 whole cell, human A549 whole cell, human Hela whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene.
Specifications
| ZP3 | |
| Polyclonal | |
| Unconjugated | |
| ZP3 | |
| Processed zona pellucida sperm-binding protein 3; Sperm receptor; zona pellucida C; zona pellucida C protein; zona pellucida glycoprotein 3; zona pellucida glycoprotein 3 (sperm receptor); zona pellucida glycoprotein 3 preproprotein; zona pellucida glycoprotein 3A (sperm receptor); zona pellucida glycoprotein 3B; zona pellucida glycoprotein ZP3; zona pellucida glycoprotein ZP3B; zona pellucida protein C; Zona pellucida sperm-binding protein 3; Zp3; Zp-3; ZP3A; ZP3A/ZP3B; ZP3B; Zp-3B; ZPC | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 7784 | |
| -20°C | |
| Lyophilized |
| Western Blot | |
| 500 μg/mL | |
| PBS with 4mg trehalose and 0.05mg sodium azide | |
| P21754 | |
| ZP3 | |
| A synthetic peptide corresponding to a sequence of human ZP3 (LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.