Invitrogen™ ZP1 Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA595360

Product Code. 16374625

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat ovary tissue, SKOV3 whole cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.

Specifications

• Antigen: ZP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: ZP1
• Gene Alias: epididymis luminal protein 163; HEL163; mgc87693; OOMD; OOMD1; Processed zona pellucida sperm-binding protein 1; Zona pellucida glycoprotein 1; zona pellucida glycoprotein 1 (sperm receptor); zona pellucida sperm-binding protein 1; ZP1; Zp-1; zp1 protein
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 22917, 85271
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: O54766, P60852
• Gene Symbols: ZP1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human ZP1 (102-139aa HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Product Type: Antibody
• Isotype: IgG