missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNRF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84196-25ul
This item is not returnable.
View return policy
Description
ZNRF1 Polyclonal specifically detects ZNRF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ZNRF1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| DKFZp434E229, EC 6.3.2, EC 6.3.2.-, FLJ14846, MGC15430, nerve injury gene 283, Nerve injury-induced gene 283 protein, nin283, NIN283E3 ubiquitin-protein ligase ZNRF1, zinc and ring finger 1, zinc and ring finger protein 1, Zinc/RING finger protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ZNRF1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLPIAPRWFSSHSGFKCPICSKSVASDEMEMHFI | |
| 25 μL | |
| Zinc Finger | |
| 84937 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction