missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF711 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94844-0.02ml
This item is not returnable.
View return policy
Description
ZNF711 Polyclonal antibody specifically detects ZNF711 in Human samples. It is validated for Western Blot
Specifications
| ZNF711 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| zinc finger protein 711 | |
| A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ZNF711 (NP_001317503.1). SEDYLMISLDDVGEKLEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAEDDVEIGGTEIVTESEYTSGHSVAGVLDQSRMQREKMVYMAVKDSSQ | |
| 0.02 mL | |
| Cell Biology | |
| 7552 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur