missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF709 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | ZNF709 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
ZNF709 Polyclonal specifically detects ZNF709 in Human samples. It is validated for Western Blot.Specifications
| ZNF709 | |
| Polyclonal | |
| Purified | |
| RUO | |
| FLJ38281, zinc finger protein 709 | |
| ZNF709 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_689814 | |
| 163051 | |
| Synthetic peptide directed towards the N terminal of human ZNF709. Peptide sequence KLRSHMVERLCERKEGSQFGETISQTPNPKPNKKTFTRVKPYECSVCGKD. | |
| Primary | |
| 75 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title