ZNF680 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-79429

Product Code. 18288855

Description

ZNF680 Polyclonal specifically detects ZNF680 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF680
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ90430, zinc finger protein 680
• Host Species: Rabbit
• Molecular Weight of Antigen: 49 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: EAW77967
• Gene Symbols: ZNF680
• Immunogen: Synthetic peptide directed towards the N terminal of human ZNF680. Peptide sequence: QCLRTTQSKIFQCDKYVKVFHKFSNSNSHKKRNTGKKVFKCKECGKSFCM
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 340252
• Target Species: Human
• Isotype: IgG