missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF675 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | ZNF675 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF675 Polyclonal specifically detects ZNF675 in Human samples. It is validated for Western Blot.Specifications
| ZNF675 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ36350, TBZF, TIZ, TRAF6 inhibitory zinc finger, TRAF6-binding zinc finger protein, TRAF6-inhibitory zinc finger protein, zinc finger protein 675 | |
| ZNF675 | |
| IgG | |
| 66 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_612203 | |
| 171392 | |
| Synthetic peptide directed towards the N terminal of human ZNF675The immunogen for this antibody is ZNF675. Peptide sequence CDKYVKVFNKFSHSDRHKIKHMENKPFKCKECGRSFCMLSHLTRHERNYT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title