missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF645 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£145.00 - £417.00
Specifications
| Antigen | ZNF645 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231633
|
Novus Biologicals
NBP3-35872-100ul |
100 μL |
£417.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30228120
|
Novus Biologicals
NBP3-35872-20ul |
20 μL |
£145.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF645 Polyclonal antibody specifically detects ZNF645 in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| ZNF645 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse, Rat | |
| CBLL2, E3 ubiquitin ligase, HAKAIL, zinc finger protein 645 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 346-425 of human ZNF645 (NP_689790.1).,, Sequence:, QNGNPSASEFASHHYNLNILPQFTENQETLSPQFTQTDAMDHRRWPAWKRLSPCPPTRSPPPSTLHGRSHHSHQRRHRRY | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 158506 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title