missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF638 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £513.00
Specifica
| Antigen | ZNF638 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|---|---|---|---|---|---|---|---|---|---|
| Codice del prodotto | Marca | Quantity | Prezzo | Quantità e disponibilità | |||||
|
18279733
|
Novus Biologicals
NBP2-56119 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18617128
|
Novus Biologicals
NBP2-56119-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Descrizione
ZNF638 Polyclonal specifically detects ZNF638 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifica
| ZNF638 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 27332 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQERIPHEPVINSSNVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKF | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| CTCL tumor antigen se33-1, CTCL-associated antigen se33-1, Cutaneous T-cell lymphoma-associated antigen se33-1, DKFZp686P1231, MGC26130, MGC90196, NP220 nuclear protein, NP220zinc finger, matrin-like, Nuclear protein 220, ZFML, Zfp638, Zinc finger matrin-like protein, zinc finger protein 638 | |
| ZNF638 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto