missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF624 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF624 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF624 Polyclonal specifically detects ZNF624 in Human samples. It is validated for Western Blot.Specifications
| ZNF624 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| KIAA1349MGC119602, MGC119603, MGC119605, zinc finger protein 624 | |
| ZNF624 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_065838 | |
| 57547 | |
| Synthetic peptide directed towards the N terminal of human ZNF624The immunogen for this antibody is ZNF624. Peptide sequence MSLQDSTLSREGKPEGEIMAAVFFSVGRLSPEVTQPDEDLHLQAEETQLV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title