missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF607 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF607 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF607 Polyclonal specifically detects ZNF607 in Human samples. It is validated for Western Blot.Specifications
| ZNF607 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ14802, MGC13071, zinc finger protein 607 | |
| ZNF607 | |
| IgG | |
| 81 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_116078 | |
| 84775 | |
| Synthetic peptide directed towards the middle region of human ZNF607. Peptide sequence KECGKGFTCRYQLTMHQRIYSGEKHYECKENGEAFSSGHQLTAPHTFESV. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title