missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF606 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF606 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF606 Polyclonal specifically detects ZNF606 in Human samples. It is validated for Western Blot.Specifications
| ZNF606 | |
| Polyclonal | |
| Rabbit | |
| NP_079303 | |
| 80095 | |
| Synthetic peptide directed towards the N terminal of human ZNF606. Peptide sequence WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLDLVQRTLY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA1852FLJ14260, Zinc finger protein 328, zinc finger protein 606, ZNF328 | |
| ZNF606 | |
| IgG | |
| 92 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title