missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF598 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
£289.00 - £442.00
Specifications
| Antigen | ZNF598 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18486650
|
Novus Biologicals
NBP1-84658-25ul |
25 μL |
£289.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18748013
|
Novus Biologicals
NBP1-84658 |
0.1 mL |
£442.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF598 Polyclonal specifically detects ZNF598 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| ZNF598 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 90850 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:TTTTTKAPRLLPAPRAYLVPENFRERNLQLIQSIRDFLQSDEARFSEFKSHSGEFRQGLISAAQYYKSCRDLLGENFQKVF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| DKFZp762F135, FLJ00086, zinc finger protein 598 | |
| ZNF598 | |
| IgG | |
| Affinity Purified | |
| Specificity of human ZNF598 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title