missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF585A Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£157.00 - £364.00
Specifications
| Antigen | ZNF585A |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ZNF585A Polyclonal antibody specifically detects ZNF585A in Human samples. It is validated for Western BlotSpecifications
| ZNF585A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ23765, FLJ25829, FLJ31827, zinc finger protein 585A | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human ZNF585A (NP_001275729.1). MPANWTSPQKSSALAPEDHGSSYEGSVSFRDVAIDFSREEWRHLDPSQRNLYRDVMLETYSHLLSVGYQVPEAEVVMLEQGKEPWALQGERPRQS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 199704 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title