ZNF552 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-09925-25UL

Código de producto. 18323214

Descripción

ZNF552 Polyclonal specifically detects ZNF552 in Human samples. It is validated for Western Blot.

Especificaciones

• Antigen: ZNF552
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: ZNF552 zinc finger protein 552
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF552 (NP_079038). Peptide sequence RSGLLQQEATHTGKSNSKTECVSLFHGGKSHYSCGGCMKHFSTKDILSQH
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79818
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.