missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF521 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £470.00
Specifications
| Antigen | ZNF521 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18429250
|
Novus Biologicals
NBP1-84882 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18457430
|
Novus Biologicals
NBP1-84882-25ul |
25 μL |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF521 Polyclonal antibody specifically detects ZNF521 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ZNF521 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Immunology, Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol | |
| 25925 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EHZF, Evi3, LIP3, ZFP521, zinc finger protein 263, Zinc finger protein FPM315, Zinc finger protein with KRAB and SCAN domains 12 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VTVGYTSVSSTTPDSNLSVDSSTMVEAAPPIPKSRGRKRAAQQTPDMTGPSSKQAKVTYSCIYCNKQLFSSLAVLQIHLKTMH | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title