missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF499 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17460-100UL
This item is not returnable.
View return policy
Description
ZNF499 Polyclonal antibody specifically detects ZNF499 in Human samples. It is validated for Immunofluorescence
Specifications
| ZNF499 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| DKFZp547H249, FLJ14486, zinc finger and BTB domain containing 45, zinc finger and BTB domain-containing protein 45, zinc finger protein 499, ZNF499 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: APPSFPDCAAGFLTAAADSACEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 84878 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction