missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF499 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF499 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF499 Polyclonal specifically detects ZNF499 in Human samples. It is validated for Western Blot.Specifications
| ZNF499 | |
| Polyclonal | |
| Rabbit | |
| NP_116181 | |
| 84878 | |
| Synthetic peptide directed towards the middle region of human ZNF499. Peptide sequence: CEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWHDEDGAVPEGC | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp547H249, FLJ14486, zinc finger and BTB domain containing 45, zinc finger and BTB domain-containing protein 45, zinc finger protein 499, ZNF499 | |
| ZBTB45 | |
| IgG | |
| 54 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title