missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF486 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF486 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF486 Polyclonal specifically detects ZNF486 in Human samples. It is validated for Western Blot.Specifications
| ZNF486 | |
| Polyclonal | |
| Rabbit | |
| NP_443084 | |
| 90649 | |
| Synthetic peptide directed towards the C terminal of human ZNF486The immunogen for this antibody is ZNF486. Peptide sequence HRRTHTGEKPYKCEECGKAYTTSSNLTEHKTTHTGEKPYKCKECGKAFNW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KOX16MGC57283, Zfp612, zinc finger protein 23, zinc finger protein 23 (KOX 16), zinc finger protein 32, Zinc finger protein 359ZNF612kruppel-like zinc finger factor X31, Zinc finger protein 612, Zinc finger protein KOX16, ZNF359 | |
| ZNF486 | |
| IgG | |
| 54 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title