ZNF483 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-31592

Product Code. 18005705

Description

ZNF483 Polyclonal specifically detects ZNF483 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZNF483
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q8TF39
• Gene Symbols: ZNF483
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLENLRNLEFLDFPVSKLELISQLKWVELPWLLEEVSKSSRLDESALDKIIERCLRDDDHGLMEESQQYCGSSEEDHGNQGNSKG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BMZF-2zinc finger 2, bone marrow, BMZF2zinc finger protein 27 (KOX 22), Bone marrow zinc finger 2, KOX22Zinc finger protein 233, zinc finger protein 224, Zinc finger protein 255Zinc finger protein KOX22, Zinc finger protein 27, ZNF255zinc finger protein ZNF255, ZNF27ZNF233
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 158399
• Target Species: Human
• Isotype: IgG

For Research Use Only