missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF431 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£375.00
Specifications
| Antigen | ZNF431 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF431 Polyclonal specifically detects ZNF431 in Human samples. It is validated for Western Blot.Specifications
| ZNF431 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DKFZp313E0830, KIAA1969, zinc finger protein 431 | |
| ZNF431 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_597730 | |
| 170959 | |
| Synthetic peptide directed towards the N terminal of human ZNF431. Peptide sequence MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title