missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF419A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10386-100UL
This item is not returnable.
View return policy
Description
ZNF419A Polyclonal specifically detects ZNF419A in Human samples. It is validated for Western Blot.
Specifications
| ZNF419A | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| zinc finger protein 419 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF419A (NP_078967). Peptide sequence MAAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRL | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 79744 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction