missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF385D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF385D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF385D Polyclonal specifically detects ZNF385D in Human samples. It is validated for Western Blot.Specifications
| ZNF385D | |
| Polyclonal | |
| Rabbit | |
| NP_078973 | |
| 79750 | |
| Synthetic peptide directed towards the C terminal of human ZNF385DThe immunogen for this antibody is ZNF385D. Peptide sequence RHKDRAAGKPPKPKYSPYNKLQKTAHPLGVKLVFSKEPSKPLAPRILPNP. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ12586, zinc finger protein 329 | |
| ZNF385D | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title