ZNF385B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-58807-25ul

Product Code. 18643297

Description

ZNF385B Polyclonal specifically detects ZNF385B in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ZNF385B
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C2H2-like zinc finger protein rearranged in thyroid adenomas, DKFZp686L0787, KRAB zinc finger protein, zinc finger protein 331, Zinc finger protein 463, ZNF463RITAZNF361Zinc finger protein 361
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 151126
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ZNF385B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSKHAKKVKALDATKNKPKMVPSKDSAKANPSCSITPITGNNSDKSEDKGKLKASSSSQP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG

For Research Use Only