missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF329 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17782-25UL
This item is not returnable.
View return policy
Description
ZNF329 Polyclonal antibody specifically detects ZNF329 in Human samples. It is validated for Immunofluorescence
Specifications
| ZNF329 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| zinc finger protein 394, zinc finger protein 99, Zinc finger protein with KRAB and SCAN domains 14, ZKSCAN14FLJ12298 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: REKPYKYPESVKSFNHFTSLGHQKIMKRGKKSYEGKNFENIFTLSSSLNENQRNLPGEKQY | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 79673 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction