missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF286 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | ZNF286 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF286 Polyclonal specifically detects ZNF286 in Human samples. It is validated for Western Blot.Specifications
| ZNF286 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| MGC149627, zinc finger protein 286, zinc finger protein 286A | |
| ZNF286A | |
| IgG | |
| 60 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_065703 | |
| 57335 | |
| Synthetic peptide directed towards the N terminal of human ZNF286. Peptide sequence GALSSQDSPHFQEKSTEEGEVAALRLTARSQETVTFKDVAMDFTPEEWGK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title